Michael Joseph Flemming # 270657 - Attorney Licensee Search

Utility

  • Configure block
  • Remove block
  • Edit menu
  • The State Bar Court of California (link is external)
  • News
  • Help Center
  • Forms
  • Logins
  • Configure block
  • Remove block
  • Configure block
  • Remove block
Home

Main navigation

  • Configure block
  • Remove block
  • Edit menu
  • Public
    • Main Pane
      • Find Legal Professionals
        • Find a Lawyer Referral Service
        • Check Attorney Profile
        • Find a Certified Specialist
      • Concerns About an Attorney
        • Office of Public Trust Liaison
        • Why File a Complaint
        • Resolving Fee Disputes with Your Attorney
        • Avoid Legal Services Fraud
        • Recent Disciplinary Actions
        • Unauthorized Practice of Law Violations
      • File Complaints & Claims
        • File an Attorney Complaint
        • Request a Complaint Review
        • Report Unauthorized Practice of Law
        • Resolve a Fee Dispute
        • Apply for Reimbursement
        • File a Lawyer Referral Service Complaint
        • Government Claims, Subpoenas, and Lawsuits Against the State Bar
        • Whistleblower and Whistleblower Retaliation Complaints
      • Legal Resources
        • Free Legal Help
        • Before Selecting an Attorney
        • Working With an Attorney
        • Resolving Problems with an Attorney
        • Resources for Immigrants
        • Resources for Veterans and Service Members
        • Legal Help After a Disaster
        • Legal Guide Pamphlets
      • Recursos en español
        • Buscando ayuda con asuntos de inmigración
        • Alerta a Propietarios Referente al Fraude de Servicios Legales
        • Alerta a Arrendatarios Referente al Fraude de Servicios Legales
        • Evite el fraude por parte de los consultores de inmigración
        • Programa de Enlace entre Abogado y Cliente
        • Intermediario de Confianza Pública
        • Después de presentar una queja contra un abogado
      • Public Meetings & Comment
        • Public Meetings
        • Public Comment
        • Public Meeting Recordings
    • Sidebar
      • Find a Certified Lawyer Referral Service
      • File a Complaint
      • Public Meetings Portal
      • Popular Links
        • Need Help? Contact the Public Trust Liaison Office
        • Recent Disciplinary Actions
        • Unauthorized Practice of Law Violations
        • Resolve a Fee Dispute
        • Tips: Avoid Legal Services Fraud
        • Forms
        • Public FAQs
  • Legal Professionals
    • Main Pane
      • Maintaining Compliance
        • Administrative Compliance
        • MCLE
        • Administrative Services
        • Administrative Regulation & Discipline
        • Client Trust Accounting & IOLTA
        • Self-Reporting Forms
        • Multijurisdictional Practice Program
        • Compliance & Records for Judges
      • Legal Specialization
        • Becoming a Certified Specialist
        • Legal Specialty Areas
        • Legal Specialization Rules & Standards
        • Certified Legal Specialist Exam Grading and Scope
        • For Current Certified Specialists
        • Digital Brochures
      • Rules
        • Rules of the State Bar
        • Rules of Professional Conduct
        • The State Bar Act
        • California Rules of the Court
      • Volunteer
        • Pro Bono Opportunities
        • Apply to be a Mandatory Fee Arbitrator
        • Special Master
      • For Entities
        • Limited Liability Partnerships
        • Law Corporations Program
        • Legal Specialization Education Providers
        • Lawyer Referral Service Providers Certification
        • MCLE Providers
      • Ethics, Compliance & Practice Resources
        • Ethics
        • Mandatory Fee Arbitration Program & Resources
        • Lawyer Assistance Program
        • Practice Management and Professional Pathways
        • E-Learning Portal
        • All Resources
    • Sidebar
      • My State Bar Profile
      • View All Login Portals
      • Popular Links
        • 2026 Attorney Annual Renewal
        • Administrative Compliance: My State Bar Profile Tasks
        • Agency Billing
        • Ethics Hotline
        • Fraud Alert: Scams Impacting Attorneys
        • Frequently Asked Questions: CTAPP
        • Legal Professionals FAQs
        • Licensee Records and Compliance Inquiry Form
  • Admissions
    • Main Pane
      • Requirements
        • Registration
        • Education
      • Examinations
        • California Bar Examination
        • First-Year Law Students' Examination
        • Multistate Professional Responsibility Examination
        • Dates and Deadlines
      • Applicant Resources
        • Testing Accommodations
        • Past Exams
        • Exam Statistics
        • Refund of Fees Policy
        • Attorney Applicants
        • Lawyer Assistance Program
      • Moral Character
        • Moral Character Statement
        • Governing Law
        • Submitting an Application
        • Factors and Conduct
        • Guidelines
      • Special Admissions
        • Multijurisdictional Practice (MJP) Program
        • Pro Hac Vice
        • Out-of-State Attorney Arbitration Counsel
        • Foreign Legal Consultants
        • Practical Training of Law Students
        • Provisionally Licensed Lawyers
      • Law Schools
        • Law Schools Regulation
        • Law Schools Directory
    • Sidebar
      • Applicant Portal
      • Popular Links
        • February 2026 California Bar Exam
        • Law Schools Directory
        • Proctors & Graders
        • Admissions FAQs
  • Access to Justice
    • Main Pane
      • Initiatives
        • Awards
        • Access to Justice Publications
      • Volunteer for Pro Bono
        • Pro Bono Practice Program
        • Pro Bono Opportunities Directory
        • Volunteer After a Disaster
        • Volunteer Opportunities to Assist Veterans & Service Members
      • Grants
        • Legal Services Trust Fund Program
        • Greg E. Knoll Justice Gap Fund
        • Legal Aid Funding
      • Financial Institutions Banking Compliance
        • IOLTA-Eligible Financial Institutions
        • Leadership Financial Institutions
    • Sidebar
      • Find a Certified Lawyer Referral Service
      • Popular Links
        • DEI Leadership Seal Program
        • Promoting Diversity, Equity, and Inclusion
  • About Us
    • Main Pane
      • Our Mission
        • Protecting the Public
        • Promoting Justice in California
        • Promoting Diversity, Equity, and Inclusion
        • State Bar Stories
        • Government Affairs
      • Who We Are
        • Board of Trustees
        • Staff
        • Committees
        • State Bar Holidays
        • Frequently Asked Questions
      • Careers
        • Make a Difference
        • Develop and Grow
        • Benefits
        • Diversity, Equity & Inclusion
        • View All Job Listings
        • Internship Program
        • Salary
      • Data & Reports
        • Discipline Statistics
        • View All
      • Business Opportunities
        • Previous Opportunities
    • Sidebar
      • Public Meetings & Comment
      • Popular Links
        • Public Records Request
        • News
        • Transparency & Accountability
        • Five Years of Reform

Additional Searches

Find a Certified Lawyer Referral Service Check Attorney Profile

Menu
  • Public
    • Find Legal Professionals
      • Find a Lawyer Referral Service
        • How a Certified Lawyer Referral Service Works
        • What a Certified Lawyer Referral Service Can Do for You
        • Find a San Francisco Bay Lawyer Referral Service
        • Find a San Diego Lawyer Referral Service
        • Find a Sacramento and Northern California Lawyer Referral Service
        • Find a Los Angeles Lawyer Referral Service
        • Find a Central Valley Area Lawyer Referral Service
        • Central Coast Area Lawyer Referral Services
      • Check Attorney Profile
      • Find a Certified Specialist
    • Concerns About an Attorney
      • Office of Public Trust Liaison
        • Office of Public Trust Liaison
          • Attorney-Client Bridge Program
      • Why File a Complaint
      • Resolving Fee Disputes with Your Attorney
        • Arbitration Advisories
        • Frequently Asked Questions: Fee Disputes
      • Avoid Legal Services Fraud
        • Unauthorized Practice of Law
          • After You File an Unauthorized Practice of Law Complaint
        • Unauthorized Practice of Law Complaint
        • Avoid Fraud by Immigration Consultants
      • Recent Disciplinary Actions
      • Unauthorized Practice of Law Violations
    • File Complaints & Claims
      • File an Attorney Complaint
        • How to File a Complaint Against an Attorney
        • After You File an Attorney Misconduct Complaint
      • Request a Complaint Review
      • Report Unauthorized Practice of Law
      • Resolve a Fee Dispute
      • Apply for Reimbursement
      • File a Lawyer Referral Service Complaint
      • Government Claims, Subpoenas, and Lawsuits Against the State Bar
      • Whistleblower and Whistleblower Retaliation Complaints
    • Legal Resources
      • Free Legal Help
        • Evite el fraude en los servicios legales de inmigración
        • Before You File
        • Free Legal Information
          • Resources & Forms
          • Consumer Protection Guidelines
      • Before Selecting an Attorney
      • Working With an Attorney
        • What to Expect Regarding Fees and Billing
      • Resolving Problems with an Attorney
        • When a Lawyer Dies
      • Resources for Immigrants
        • Legal Aid Providers
      • Resources for Veterans and Service Members
      • Legal Help After a Disaster
      • Legal Guide Pamphlets
    • Recursos en español
      • Buscando ayuda con asuntos de inmigración
      • Alerta a Propietarios Referente al Fraude de Servicios Legales
      • Alerta a Arrendatarios Referente al Fraude de Servicios Legales
      • Evite el fraude por parte de los consultores de inmigración
      • Programa de Enlace entre Abogado y Cliente
      • Intermediario de Confianza Pública
      • Después de presentar una queja contra un abogado
    • Public Meetings & Comment
      • Public Meetings
        • Request to Comment at a Public Meeting
          • Remote Participation Tips
        • State Bar Committee and Commissions Meeting Archive
        • Board of Trustees Meeting Archive
        • Meetings: State Bar Committees and Commissions
        • Strategic Plan 2022-2027
        • Meetings: Board of Trustees
      • Public Comment
        • Proposed Formal Opinion Interim No. 21-0003 (Ethics of In-House Counsel) (Reissued)
        • Public Comment Archives
          • 2026 Public Comment
            • Proposed New and Revised Rules Related to Qualified Support Center Grant Requirements
            • Proposed New Rule 1.26 of the State Bar Rules Relating to the Discretion of the Executive Director or Their Designee to Waive Certain Fees and Extend Specified Deadlines
            • Proposed Modifications to Rules Related to Lawyer Referral Services
            • Proposals to Implement an Alternative Dispute Resolution Certification Program
            • Proposed New Rule 2.3 of the State Bar Rules Regarding the Civility Oath (Reissued)
            • Proposed Amendments to the Rules of Court and the State Bar Rules Regarding the Procedure Upon Suspension for Nonpayment (Reissued)
            • Proposed Formal Opinion Interim No. 21-0003 (Ethics of In-House Counsel)
            • Proposed New and Revised Rules Related to Grants Administration
            • Proposed Amendments Rules Related to Lawyer Referral Services
            • Proposed Amendments to the Rules of Court and the State Bar Rules Regarding the Procedure Upon Suspension for Nonpayment
          • 2025 Public Comment
            • Proposed Amendments to Client Trust Account Protection Program Rules
            • Proposed Amendments to Rule 2.45 Regarding Voluntary Resignation
            • Proposed Amendments to Rules of Professional Conduct 8.2 and 8.4
            • Proposed Formal Opinion Interim No. 19-0004 (Client File Release and Retention Duties)
            • Proposed New and Revised Rules Related to Grants Administration
            • California Supreme Court Proposes Amendments to Rules Governing the Bar Exam and Other Admissions Matters
            • Proposed Amendments to Rules of Procedure Related to Probation
            • Proposed Amended Rule of Professional Conduct 7.3
            • Proposed Program to Allow Waivers of Filing Fees and Waivers of Transcript Costs in State Bar Court
            • Proposed Amendments to State Bar Rules on Governance, Fees, and Procedures
            • Proposed Changes to the Rules of Procedure Regarding the Alternative Discipline Program
            • Proposed Scope of Client Trust Account Protection Program Compliance Review Procedures
            • Proposed Rule Revisions Regarding the Practical Training of Law Students
            • Proposed Standards for Certification and Recertification in Privacy Law
            • Proposed Amended Rules of Professional Conduct 8.2 and 8.4 (Reissued)
            • Proposed New Rule 2.3 of the State Bar Rules Regarding the Civility Oath
            • Proposed Formal Opinion Interim No. 20-0001 (Lawyer as Expert Witness)
            • Proposed Revisions to Rules Pertaining to the Law Office Study Program
            • Proposed Amended Rules of Professional Conduct 8.2 and 8.4
            • Proposed Amendment to Rules of Court Governing Stipulations and New Rule of Court Related to Professional Responsibility Examination
            • Proposed New State Bar Policy Regarding the Removal of Criminal Conviction Transmittal Notation from the Attorney Profile Page
            • Proposed Revised Formal Opinion Interim No. 20-0003 (Flat Fees and Termination)
          • 2012 Public Comment
            • Proposed Formal Opinion Interim No. 11-0002 (Deceitful Conduct)
            • Proposed Formal Opinion Interim No. 09-0001B (Duty of Confidentiality and Seeking Legal Advice)
          • 2013 Public Comment
          • 2010 Public Comment
            • Proposed Formal Opinion Interim No. 08-0002 (Confidentiality and Technology) Reissued
          • 2011 Public Comment
          • 2014 Public Comment
            • Proposed Formal Opinion Interim No. 12-0007 (Puffing in Negotiations)
            • Proposed Formal Opinion Interim No. 11-0003 (Dissolving Firm and Moving to New Firm)
            • Proposed Revisions to the Rules of Procedure of the State Bar of California Title 5, Discipline
          • 2015 Public Comment
            • Proposed Formal Opinion Interim No. 12-0006 (Attorney Blogging)
          • 2016 Public Comment
          • 2019 Public Comment
            • Proposed Changes to the Responsibilities of the California Board of Legal Specialization (CBLS)
            • Proposed Formal Opinion Interim No. 12-0003 (Attorney Directory and Rating Websites)
            • Options for Regulatory Reforms to Promote Access to Justice
            • Proposed New and Amended Rules of Procedure of the State Bar Regarding Vexatious Complainants
            • Proposed Revised Formal Opinion Interim No. 14-0004 (Witness Perjury)
            • Amendment to Rule of Procedure 2201 (Appointment and Authority)
            • Proposal to Eliminate the Committee on Mandatory Fee Arbitration
            • Proposed Rule Changes Addressing Public Licensee Information and Required Reporting
            • Proposed Amended California Rules of Professional Conduct Regarding File Release and Retention Duties
            • Proposed Changes to State Bar Rules to Revise the Role of the Committee of Bar Examiners for the Purpose of improving Governance and Service Delivery
            • Proposed State Bar Rule of Procedure Setting Forth Guidelines for the Imposition and Collection of Monetary Sanctions
            • Proposed Formal Opinion Interim No. 13-0003 (Ethical Obligations When Departing Firm)
            • Proposed Changes to State Bar of California Model Rules of Procedure Rule 38.1 and State Bar Rule 3.536(E), Regarding Arbitrator Compensation
            • Proposed Formal Opinion Interim No. 12-0003 (Attorney Directory and Rating Websites)
          • 2024 Public Comment
            • State Bar Policy on Law School Name Changes
            • Proposed Amendments to State Bar Rules Governing Commission on Judicial Nominees Evaluation (JNE)
            • Proposed Amended Conflict of Interest Code for Designated State Bar Employees
            • Proposed State Bar Rules and Rule Amendments Related to Grants Administration
            • Proposed Amendments to State Bar Rules Regarding Pro Bono Practice Program
            • Proposed Amendments to the Rules of Procedure Relating to Early Neutral Evaluation Conferences
            • Proposed Amendment to State Bar Rule Regarding Schedule of Fees and Deadlines (Rule 1.22)
            • Clarifying and Corrective Amendments to Multiple State Bar Rules
            • Proposed Amendments to Rule of Procedure Governing Probation
            • Proposed Arbitration Advisory Interim No. 2022-0XA (Standard of Review in Fee Disputes Where There Is a Written Fee Agreement)
            • Proposed Amendments to Attorney Sanction Standards: Effect of Prior Discipline
            • Proposed Amendments to State Bar Rules Relating to Pro Bono Practice Program
            • Proposed Formal Opinion Interim No. 20-0003 (Flat Fees and Termination)
            • Proposed Revised Formal Opinion No. 2021-206 (Colleague Impairment)
            • Proposed Arbitration Advisory Interim No. 2022-0XB (Determination of a “Reasonable” Fee)
            • Proposed Formal Opinion Interim No. 20-0005 (Conversion Clauses in Contingent Fee Agreements)
            • Proposed Amendments to Rules of Procedure of the State Bar Regarding Remote Appearances in State Bar Court Proceedings
            • Proposed New Rule of Procedure Regarding Vexatious Litigants in State Bar Court
            • Proposed Amendments to Rules Relating to Attorney Reporting and the Timing of the Annual Renewal Cycle
            • Proposed New Rule 9.33 of the Rules of Court Regarding the Expungement of Nondisbarment Discipline
            • Proposed Amendments to Rules of the State Bar Regarding the Lawyer Assistance Program
            • Proposed Amendments to California Rules of Court, Rule 9.23
            • Proposed Formal Opinion Interim No. 20-0002 (Succession Planning)
            • Proposed Formal Opinion Interim No. 21-0003 (Ethics of In-House Counsel)
            • Proposed Amendments to Rules of Procedure 5.28 (Computing Time) and 5.127 (Public and Private Reprovals)
            • Proposed State Bar Rule to Implement Offer and Compromise Program
            • Proposed New State Bar Policy Regarding the Removal of Nondisbarment Discipline, Administrative Suspensions, and Inactive Enrollments
            • Proposed Amendments to Rule 2.31 Relating to the Deadline for Submission of the Transfer to Inactive Status Form and the Effective Date of the Transfer
          • 2022 Public Comment
            • Proposed Formal Opinion Interim No. 20-0005 (Conversion Clauses in Contingency Fee Agreements)
            • Proposed Formal Opinion Interim No. 19-0004 (Client File Release and Retention Duties)
            • Elimination of Time Limit on the Validity of a Passing Bar Examination Score
            • Proposed New Case Processing Standards
            • Proposed Amendments to Rule 3.513 (Electronic Submissions in Mandatory Fee Arbitration)
            • Proposed Amendment to Rule 2.11 (Due date and form of payment, licensee fees)
            • Proposed Amendments to State Bar Rule 7.40 (Assignment of Judicial Nominees Evaluation Commissioners)
            • Proposed New Rule of Court and Amended Rules of Professional Conduct for the Client Trust Account Protection Program (CTAPP)
            • California Paraprofessional Program Recommendations
            • Proposed Formal Opinion Interim No. 20-0004 (Ethical Obligations When Working Remotely)
            • Ad Hoc Commission on the Discipline System Recommendations
              • Ad Hoc Commission on the Discipline System Roster
            • Proposed Amendments to the Rules of Procedure of the State Bar, Provisional Licensure Program
            • Proposed Amendments to the Rules of Procedure of the State Bar, Remote Court Proceedings
            • Proposed Amendment to Rule of Procedure 5.80 (Motion for Entry of Default)
            • Proposed Amendments to the Rules of Procedure of the State Bar, Rule 5.127 (Public and Private Reprovals) and Rule 5.155 (Actions by Review Department)
            • Proposed Amendments to Rules of Procedure 5.65 (Discovery Procedures), 5.337 (Expedited Proceeding; Limited Discovery), and 5.345 (Hearing Department Procedures)
            • Proposed Amendments to Rule of Procedure 5.21 (Limitations Period)
            • Proposed New State Bar Rule, Amended Rule of Professional Conduct, and Amended New Rule of Court for the Client Trust Account Protection Program (CTAPP)
          • 2017 Public Comment
            • Proposed Formal Opinion Interim No. 12-0003 (Attorney Directory and Rating Websites) (September 2017)
            • 2017 Standard Setting Study and Related Options
          • 2021 Public Comment
            • Proposed Formal Opinion Interim No. 17-0003 (Considers Duty to Prospective Client)
            • Proposed Revised Rules for Accredited Law Schools
            • Proposed Arbitration Advisory Interim No. 2020-0XB (Handling Disputes Regarding Costs and Expenses)
            • Proposed Rule 3.453 Governing Client Security Fund Payment Plans for Nondisbarred and Nonresigned Licensees
            • Proposed Revisions to State Bar Rule 3.662 Regarding Legal Services Trust Fund Commission Term of Appointments
            • Proposed Formal Opinion Interim No. 19-0003 (Improper Contract Provisions)
            • Proposed Formal Opinion Interim No. 13-0002 (Client with Diminished Capacity)
            • Amendment to Rule of Procedure 2201 (Appointment and Authority)
            • Proposed Amendments to State Bar Rules 3.440, 3.445 (Client Security Fund- Electronic Service and Electronic Signatures)
            • Proposed Formal Opinion Interim No. 19-0003
            • Proposed Amendment to Rule of Procedure 2201 (Appointment and Authority)
            • Proposed Amendments to State Bar Rule 7.61 Regarding Voting Procedures of the Commission on Judicial Nominees Evaluation
            • Proposed Formal Opinion Interim No. 20-0004 (Ethical Obligations When Working Remotely)
            • Proposed Formal Opinion Interim No. 19-0004 (Client File Release and Retention Duties)
            • Proposed Amendments to 4.160(D)(6), Minimum, Cumulative Five-Year Bar Passage Rate (MPR)
            • Proposed Amendments to Rule 9.23 of the California Rules of Court
            • Proposed Technical Amendment to Rule 2.53 Governing Minimum Continuing Legal Education (MCLE) Requirements for New Licensees
            • Proposed Formal Opinion Interim No. 17-0003 [Duty to Prospective Client]
            • Proposed Formal Opinion Interim No. 14-0001 (Colleague Impairment)
            • Proposed Revised State Bar Rule 4.90 Regarding Testing Accommodations
          • 2023 Public Comment
            • Proposed Amendments to the Rules of the State Bar Pertaining to Testing Accommodations
            • Proposed Amendments to Title 4 of the Rules of the State Bar Pertaining to Moral Character
            • Proposed Rule Revisions Regarding the Practical Training of Law Students (PTLS) Program
            • Proposed New Rule of Professional Conduct 8.3 (Reporting Professional Misconduct)
            • Proposed Amendments to State Bar Rules Related to Grants Administration
            • Proposed Amendment Requiring Attorneys to Complete Annual Civility Pledge
            • Proposed Amendments to the Rules of Professional Conduct Addressing Incivility
            • Proposed Amendments to Rules Governing Minimum Continuing Legal Education (MCLE)
            • Report from the Blue Ribbon Commission on the Future of the California Bar Exam
            • Proposed New Rule of Professional Conduct 8.3
            • Admissions Fee Increase Proposal
            • Proposed Amendments to Rules Governing Minimum Continuing Legal Education (MCLE)
            • Revised Proposed Amendments to the Rules of Professional Conduct Addressing Incivility
            • Revised Proposed Amendment Requiring Attorneys to Complete Annual Civility Pledge and New State Bar Rule for Implementation
            • Revised Proposed Amendments to the Rules of the State Bar Pertaining to Testing Accommodations
            • Proposed Changes to the Administration of the California Bar Exam
            • Revised Proposed Amendments to State Bar Rules Related to Grants Administration
            • Proposal for a Portfolio Bar Examination
            • Proposed New Rule of Court 9.8.1
            • Fees Charged to California Accredited Law Schools: Modified Proposal
            • Update to Rules of Court Re: Fees for Pro Hac Vice and Out-of-State Attorney Arbitration Counsel
            • Proposed Formal Opinion Interim No. 20-0001 (Lawyer as Expert Witness)
            • Proposed Amendments to California Rules of Court 9.11 and 9.90
            • Proposed Amended Conflict of Interest Code for the Board of Trustees
            • Revised Amendments to Testing Accommodations Rules
            • Proposed Amendments to Rules Governing Mandatory Fee Arbitration (MFA)
            • Proposed Amendments to the California Rules of Court and Title 2 of the State Bar Rules Regarding the Rights and Responsibilities of Licensees
            • Proposed Amendments to the Rules of the State Bar Regarding Moral Character for Out-of-State Attorney Applicants and Examinations (Rules 4.41 and 4.62)
            • Proposed Amendments to State Bar Rules 7.52 (Commission on Judicial Nominees Evaluation In-Person Candidate Interviews) and 7.60 (Meeting Requirements)
            • Proposed Revisions to Rules Pertaining to the Law Office Study Program
          • 2020 Public Comment
            • Proposed Formal Opinion Interim No. 14-0002 (Alternative Litigation Funding)
            • Proposed Formal Opinion Interim No. 16-0002 (Data Breaches)
            • Proposed Formal Opinion Interim No. 17-0001 (Advising a Cannabis Business)
            • Provisional Licensure with a Pathway to Full Licensure
            • Amendment to Rules of Procedure Governing Fee Arbitration Award Enforcement Proceedings
            • Proposed Formal Opinion Interim No. 14-0001 (Colleague Impairment)
            • Amendment to Lawyer Referral Service Proposed Rules of Procedure
            • Proposed Arbitration Advisory Interim No. 2020-0XA (Awards of Interest under the Mandatory Fee Arbitration Program)
            • New Provisional Licensure Rule, Rule of Court XX
            • Proposed New and Amended State Bar Rules of Procedure, Rule 5.137
            • Proposed Amendments to Rules and Proposed New Rules Regarding Electronic Service and Electronic Signatures
            • Proposed Amended California Rule of Professional Conduct 5.4 [Financial and Similar Arrangements with Nonlawyers]
            • Proposed Amendments to Rule of Procedure Regarding Electronic Trial Exhibits
            • Proposed Amendment to Client Security Fund Rules
            • Proposed Changes to Elimination of Bias MCLE Rules
            • Proposed Formal Opinion Interim No. 14-0002 (Alternative Litigation Funding)
            • Proposed Rules of Procedure Governing the Review Process for Certification, Revocation, and Suspension Decisions Regarding Lawyer Referral Services
            • Proposed Amended California Rule of Professional Conduct 1.1 (Competence)
            • Proposed Formal Opinion Interim No. 16-0002 (Data Breaches)
            • Proposed Changes to State Bar Rules Regarding Electronic Service of Process and Videoconference Appearances
          • 2018 Public Comment
            • Proposed Formal Opinion Interim No. 14-0003 (Settling Before Withdrawal)
        • Proposed Formal Opinion Interim No. 20-0003 (Flat Fees and Termination)
        • Proposed Amendments to California Rule of Court, Rules 9.6 and 9.31 and State Bar Rules 2.32 and 2.50
        • Proposed amendments to Rule 1.7 (Conflicts of Interests: Current Clients) of the Rules of Professional Conduct of the State Bar of California
        • Proposed amendments to the State Bar rules regarding law corporations
        • Proposed Amendments to Guideline 6.9 of the Guidelines for Accredited Law School Rules
        • Proposed Adjustments to Law School Fees
        • Proposed Amendments to the Rules of Professional Conduct
        • Proposed Amendments to the Rules of Professional Conduct (August 2017)
        • Proposed Amendments to Law School Regulation Rules
        • 2017 Content Validation Study on the California Bar Examination
        • Proposed Amendments to Admissions Rules re Qualification of Out-of-State Attorney Applicants to File Moral Character Determination Applications
        • Proposed Amendments to the Law School Regulation Statutes and Rules re Mandatory Accreditation of Law Schools
        • Proposed Amendments to Standards 2.2, 2.5, 2.6, 2.13, 2.15, and 2.21 of the Standards for Attorney Sanctions for Professional Misconduct
        • Proposed changes to MCLE Rule 2.54
        • Proposed Formal Opinion Interim No. 10-0001 (Social Networking)
        • Proposed modification to the Rule 31 of the State Bar Rules of Procedure for Fee Arbitrations re: subpoenas
        • Proposed Modification to Rule 30.0 (“Subpoenas”), State Bar of California Model Rules of Procedure for Fee Arbitrations
        • Proposed Formal Opinion Interim No. 09-0001B (Duty of Confidentiality and Seeking Legal Advice)
        • Conflict of Interest Code for Designated Employees
        • Proposed Formal Opinion Interim No. 09-0001A (State Bar Complaint Threats)
        • Proposed Further Amendments to Rule 5.30, subdivisions (A) and (C), Rules of Procedure of the State Bar-Release for Additional Public Comment
        • Proposals For Sequence Of Elections Under Revised State Bar Districts Effective January 1, 2012
        • Proposed Formal Opinion Interim No. 09­0001A (State Bar Complaint Threats)
        • Proposed changes to MCLE Rule 2.54
        • Proposed amendments to Rules 5.30 and 2409, Rules of Procedure of the State Bar
        • Proposed Formal Opinion Interim No. 08 0003 (Serving Subpoenas on Existing Clients of a Law Firm) – 90-day Public Comment Circulation
        • Proposed Revisions to State Bar Rules Title 6, Division 2, Chapters 1 and 2 regarding State Bar Open Meeting Rules
        • Proposed Online Posting of Consumer Alert re Attorneys Charged with Significant Loan Modification Misconduct and Petition filed under Business & Professions Code section 6007(c) involving Loan Modific
        • Provision of Core Curriculum of 25 hours of Free Online MCLE in Legal Ethics
        • Proposed Formal Opinion Interim No. 10 0002 (Communications with Opposing Counsel’s Implied Consent Under the “No Contact” Rule) – 90-day Public Comment Circulation
        • Proposed Online Posting of Major Misappropriation Consumer Alert and Petition
        • Proposed Formal Opinion Interim No. 06-004 (Confidential Information and Unsolicited E-Mail Correspondence) -- Additional 60-day public comment circulation
        • Proposed administrative amendments to the Admissions Rules
        • Proposed Expungement of MCLE Inactive Enrollment - Rule of Court 9.6
        • Amendments to Rule 2.16 of the State Bar Rules, regarding Fee Waivers
        • Proposed Amendments to Rule 9.21 of the California Rules of Court, Resignation of State Bar Members with Disciplinary Charges Pending
        • Proposed Formal Opinion Interim No. 08 0001 (Gifts from Clients) – Additional 45-day Public Comment Circulation
        • Proposed New Rule 6.62 re Location of State Bar Board-Appointed Committee Meetings, Release for Public Comment
        • Proposed Formal Opinion Interim No. 08-0002
        • Conflict of Interest Code for Designated Employees (2010) - 30-Day Public Comment
        • State Bar Rule 6.9 - California Young Lawyer Governor, Proposed Amendment
        • Proposed amendments to Division 8, Library Requirements contained in the Guidelines for Accredited Law School Rules
        • Proposed amendments to Division 8, Library Requirements
        • Proposed Amendments to Standards for Certification in Immigration and Nationality Law.
        • Proposed revision of Rule 9.30, Rules of Court re Unaccredited Law Schools
        • Proposed revisions to the Lawyer Referral Service Rules
        • Proposed amendments to the State Bar Rules by the JNE Process Review Committee
        • Proposed revisions to State Bar Sample Fee Agreement forms
        • Seven proposed new or amended Rules of Professional Conduct of the State Bar of California developed by the State Bar’s Special Commission for the Revision of the Rules of Professional Conduct.
        • Proposed Law Corporation Rules
        • Proposed Formal Opinion Interim No. 06‑0004 (Confidential Information and Unsolicited E-Mail Correspondence)
        • Proposed Formal Opinion Interim No. 08-0001 (Gifts from Clients)
        • Proposed Amendments to the Standards for Attorney Sanctions for Professional Misconduct
        • Proposed Amendments to Conflict of Interests for the Board of Governors of the State Bar of California
        • Proposed Amendments to Standards for Certification in Admiralty and Maritime Law re Alternative to the Examination
        • Proposed modifications to Rules of Procedure of The State Bar of California
        • Proposed Revisions to the State Bar’s Rules of Procedure for Fee Arbitrations
        • 90-day public comment on 69 proposed new or amended Rules of Professional Conduct
        • Redistricting and Reapportionment of State Bar Districts - 45 Day Public Comment Period
        • Proposed Revisions to the Guidelines and Minimum Standards for the Operation of Mandatory Fee Arbitration Programs
        • Proposed Revisions to Notice of Your Rights After Fee Arbitration Form
        • Twelve proposed new or amended Rules of Professional Conduct of the State Bar of California
        • Proposed Revisions to the State Bar’s Model Rules of Procedure for Fee Arbitrations
        • Proposed Law Corporations Rules
        • Proposed Limited Liability Partnership Rules
        • Proposed Amendments to the State Bar Rules, Divisions 1 and 3, Individuals not Members of State Bar
        • Proposed Formal Opinion Interim No. 08‑0002 (Confidentiality and Technology)
        • Proposed Amended Rule of Professional Conduct 7.3 (Reissued)
        • Proposed Amendments to Rules Authorizing State Bar to Limit Payment to Credit Card and ACH (Electronic Check)
        • Proposed Amendment to State Bar Rule 3.114 Regarding Specialty Education Noncompliance Fee for Certified Legal Specialists
        • Proposed Amendments to Rules Governing Mandatory Fee Arbitration Program and Proposed New Fee Mediation Rules
      • Public Meeting Recordings
    • Find a Certified Lawyer Referral Service
    • File a Complaint
    • Public Meetings Portal
    • Need Help? Contact the Public Trust Liaison Office
    • Recent Disciplinary Actions
    • Unauthorized Practice of Law Violations
    • Resolve a Fee Dispute
    • Tips: Avoid Legal Services Fraud
    • Forms
    • Public FAQs
  • Legal Professionals
    • Maintaining Compliance
      • Administrative Compliance
        • Opening and Managing a Law Office
          • What Happens When a Lawyer Dies
          • Revoking a Law Corporation
        • Ethics & Technology Resources
        • Reporting Requirements
          • Fingerprinting Rule Requirements
            • Limited Accommodations
            • Fingerprinting Rule Requirements for Out-of-Country Attorneys
        • Fees & Payment
          • Frequently Asked Questions: 2025 Annual Fees
        • FAQ: Attorney Mandatory Reporting
        • Attorney Discipline
      • MCLE
        • MCLE Rules
        • Continuing Legal Education
        • E-Learning Portal
          • Frequently Asked Questions: E-Learning Portal
        • New Attorney Training Program
        • MCLE Compliance
          • Frequently Asked Questions: MCLE Audit
        • MCLE Requirements
          • Types of MCLE Credit
          • Attorney Exemptions
          • Approval for MCLE Activities
          • Approved Jurisdictions
          • Inactive and "Not Eligible to Practice"
          • Out-of-State Residents
          • Good Cause Modification - Modified Requirements
          • MCLE Proportional Requirement
        • Compliance Groups
        • Frequently Asked Questions: MCLE & CLE
      • Administrative Services
        • Address Change
        • Attorney Status Changes
          • Certificates of Standing
      • Administrative Regulation & Discipline
        • Lawyer Regulation FAQ
        • Lawyer Regulation
      • Client Trust Accounting & IOLTA
        • CTAPP Compliance Review
        • Client Trust Account Protection Program
          • Frequently Asked Questions: Client Trust Account Protection Program
        • Client Trust Accounting Handbook
        • Client Trust Accounting Resources
        • Client Trust Account Registration
        • Client Trust Account Guidelines for Attorneys
        • IOLTA Guidelines for Attorneys
        • Client Trust Accounts and Banks Stability Concerns
        • Frequently Asked Questions: IOLTA
      • Self-Reporting Forms
      • Multijurisdictional Practice Program
      • Compliance & Records for Judges
        • Fingerprinting Rule Requirements for Out-of-State Attorneys
        • Fingerprinting Rule Requirements for In-State Attorneys
    • Legal Specialization
      • Becoming a Certified Specialist
        • Legal Specialization Exam Refund Policy
        • Legal Specialist Exam Results
        • MCLE Requirements for Certified Specialists
        • October 2025 Certified Legal Specialist Examination
      • Legal Specialty Areas
      • Legal Specialization Rules & Standards
      • Certified Legal Specialist Exam Grading and Scope
      • For Current Certified Specialists
      • Digital Brochures
    • Rules
      • Rules of the State Bar
        • Title 1. Global Provisions
        • Title 2 Rights and Responsibilities of Licensees
          • Division 1. Licensee Record
          • Division 2. Annual License Fees and Penalties
          • Division 3. Licensee Status
          • Division 4. Minimum Continuing Legal Education
          • Division 1.5. Client Trust Account Protection Program
          • Division 6. New Attorney Training
          • Division 5. Trust Accounts
        • Title 3 Programs and Services
          • Title 3 Div 3 Ch 3 Pro Hac Vice
          • Chapter 5. Offer and Compromise Program
          • Chapter 4. Approval to Certify Legal Specialists
          • Chapter 3. Lawyer Referral Services
          • Chapter 1. Providers of Continuing Legal Education
          • Chapter 4. Foreign Legal Consultants
          • Chapter 3. Pro hac vice
          • Chapter 2. Out-of-state Attorney Arbitration Counsel
          • Article 3. Registered In-House Counsel
          • Article 2. Registered Legal Aid Attorneys
          • Article 1. Registered Military Spouse Attorney
          • Chapter 6. Pro Bono Practice Attorneys
          • Chapter 5. Lawyer Assistance Program
          • Chapter 4. Limited Liability Partnerships
          • Chapter 3. Law Corporations
          • Chapter 2. Legal Specialization and Articles I - XI
          • Chapter 1. Sections
          • Chapter 1. Practical Training of Law Students
        • Title 4 Admissions and Educational Standards
          • Division 3. Unaccredited Law School Rules
          • Division 2. Accredited Law School Rules
          • Division 1. Admission to Practice Law in California
        • Title 5 Discipline
        • Title 6 Governance
          • Referendum to Entire Membership
          • Meetings of the State Bar
          • Rule 6.91. Offices of the State Bar of California
          • Chapter 2. Meetings of State Bar Committees
          • Chapter 1. Meetings of the Board of Trustees
          • Chapter 4. Responsibilities of Officers
          • Chapter 3. State Bar Districts
          • Chapter 2. General Authority of the Board
          • Chapter 1. Election of Trustees
        • Title 7. JNE Rules and Miscellaneous Provisions
          • Division 2. Special Masters
            • Title 7 Div 2 Special Master Rules
          • Division 1. Commission on Judicial Nominees Evaluation
        • Appendix A: Schedule of Charges and Deadlines
        • Appendixes
      • Rules of Professional Conduct
        • Current Rules of Professional Conduct
          • Chapter 2. Counselor
          • Chapter 8. Maintaining the Integrity of the Profession
          • Chapter 7. Information About Legal Services
          • Chapter 6. Public Service
          • Chapter 5. Law Firms and Associations
          • Chapter 4. Transactions with Persons Other than Clients
          • Chapter 3. Advocate
          • Chapter 1. Lawyer-Client Relationship
          • Terminology (Rule 1.0.1)
          • Purpose and Function of the Rules of Professional Conduct (Rule 1.0)
        • Previous Rules of Professional Conduct
          • Rule 1-110 Disciplinary Authority of the State Bar
          • Rule 1-100
          • Rule 1-120 Assisting, Soliciting, or Inducing Violations
          • Rule 1-200 False Statement Regarding Admission to the State Bar
          • Rule 1-300 Unauthorized Practice of Law
          • Rule 1-310 Forming a Partnership With a Non-Lawyer
          • Rule 1-311 Employment of Disbarred, Suspended, Resigned, or Involuntarily Inactive Member
          • Rule 1-320 Financial Arrangements With Nonlawyers
          • Rule 1-400 Advertising and Solicitation
          • Rule 1-500 Agreements Restricting a Member's Practice
          • Rule 5-320 Contact with Jurors
          • Rule 5-310 Prohibited Contact with Witnesses
          • Rule 5-300 Contact with Officials
          • Rule 5-220 Suppression of Evidence
          • Rule 5-210 Member as Witness
          • Rule 5-200 Trial Conduct
          • Rule 5-120 Trial Publicity
          • Rule 5-110 Special Responsibilities of a Prosecutor
          • Rule 5-100 Threatening Criminal, Administrative, or Disciplinary Charges
          • Rule 4-400 Gifts From Client
          • Rule 4-300 Purchasing Property at a Foreclosure or a Sale Subject to Judicial Review
          • Rule 4-210 Payment of Personal or Business Expenses Incurred by or for a Client
          • Rule 4-200 Fees for Legal Services
          • Rule 4-100 Preserving Identity of Funds and Property of a Client
          • Rule 3-700 Termination of Employment
          • Rule 3-600 Organization as Client
          • Rule 3-510 Communication of Settlement Offer
          • Rule 3-500 Communication
          • Rule 3-410 Disclosure of Professional Liability Insurance
          • Rule 3-400 Limiting Liability to Client
          • Rule 3-320 Relationship With Other Party’s Lawyer
          • Rule 3-310 Avoiding the Representation of Adverse Interests
          • Rule 3-300 Avoiding Interests Adverse to a Client
          • Rule 3-210 Advising the Violation of Law
          • Rule 3-200 Prohibited Objectives of Employment
          • Rule 3-120 Sexual Relations With Client
          • Rule 3-110 Failing to Act Competently
          • Rule 3-100 Confidential Information of a Client
          • Rule 2-400 Prohibited Discriminatory Conduct in a Law Practice
          • Rule 2-300 Sale or Purchase of a Law Practice of a Member, Living or Deceased
          • Rule 2-200 Financial Arrangements Among Lawyers
          • Rule 2-100 Communication With a Represented Party
          • Rule 1-710 Member as Temporary Judge, Referee, or Court-Appointed Arbitrator
          • Rule 1-700 Member as Candidate for Judicial Office
          • Rule 1-650 Limited Legal Services Programs
          • Rule 1-600 Legal Service Programs
      • The State Bar Act
      • California Rules of the Court
    • Volunteer
      • Pro Bono Opportunities
        • Sacramento and Northern California Pro Bono Directory
        • San Francisco Area Pro Bono Directory
        • San Diego and Imperial Valley Pro Bono Directory
        • Los Angeles Area Pro Bono Directory
        • Central Coast Area Pro Bono Directory
        • Central Valley Area Pro Bono Directory
        • Statewide Pro Bono Directory
      • Apply to be a Mandatory Fee Arbitrator
      • Special Master
        • Special Master Rules
        • Special Master List
    • For Entities
      • Limited Liability Partnerships
      • Law Corporations Program
      • Legal Specialization Education Providers
      • Lawyer Referral Service Providers Certification
      • MCLE Providers
        • Single Activity Providers
        • Multiple Activity Providers
        • MCLE Provider Responsibilities
        • MCLE Activity Approval
        • Frequently Asked Questions: MCLE Providers
    • Ethics, Compliance & Practice Resources
      • Ethics
        • Construction-Related Claims Information for Attorneys
        • Ethics Publications
          • Publication 250
          • California Compendium on Professional Responsibility Index
          • Hotliner Articles
        • Ethics Opinions
          • 2009-176 to Present
          • CAL 1965-1 to CAL 1970-23
        • Ethics & Technology Resources
          • Miscellaneous
          • Internet/Email Scams
          • Social Media
          • Law Firm Websites
          • Electronic Files
          • Online Participatory MCLE Programs Related to Technology
          • Ethics Articles on Technology
          • Ethics Opinions Related to Technology
          • Online Communication
        • Judicial Ethics Resources
        • Ethics & Client Trust Account Schools
        • Ethics News
          • Ethics News Archive
        • Online Ethics MCLE
          • Registration Completed
        • Ethics Hotline
          • Frequently Asked Questions: Ethics Hotline Service
          • Archives of Ethics Hotliner
        • Attorney Civility and Professionalism
        • Ethics Hotline Research Assistance Request Form
        • Rule 8.3 Required Reporting
      • Mandatory Fee Arbitration Program & Resources
        • Mandatory Fee Arbitrator Training Course
        • Mandatory Fee Arbitration Approved Programs
        • Why Apply to be a State Bar Mandatory Fee Arbitrator?
      • Lawyer Assistance Program
        • Refocus: ADHD Strategies for Success in Law
        • Frequently Asked Questions: Lawyer Assistance Program
        • LAP Offerings
        • Monitored LAP
        • Lawyer Assistance Program Support Services
      • Practice Management and Professional Pathways
        • Succession Planning for California Attorneys
        • Ethics Opinions
        • Online MCLE
        • Rules and Statutes
        • Publications and Guides for Senior Lawyers
        • Links
      • E-Learning Portal
      • All Resources
        • Wall Admission Certificate
        • Email Safelisting Tips for Attorneys
        • Voluntary Contributions
        • Regulatory Information for Attorneys Impacted by the California Fires
        • A Wellness Guide for Senior Lawyers and Their Families, Friends, and Colleagues
        • Immigration Notice
        • Legal Research
        • CTAPP Training
    • My State Bar Profile
    • View All Login Portals
    • 2026 Attorney Annual Renewal
    • Administrative Compliance: My State Bar Profile Tasks
    • Agency Billing
    • Ethics Hotline
    • Fraud Alert: Scams Impacting Attorneys
    • Frequently Asked Questions: CTAPP
    • Legal Professionals FAQs
    • Licensee Records and Compliance Inquiry Form
  • Admissions
    • Requirements
      • Registration
        • Proof of Admission and Good Standing in Another Jurisdiction
        • FAQ: Admissions Information Management System (AIMS)
      • Education
        • Legal Education
          • Study in a Law Office or Judge's Chamber
            • Frequently Asked Questions: Law Office Study Program
            • Applying to the Law Office Study Program
            • Additional Requirements for the Law Office Study Program
          • Correspondence or Distance Learning
          • Legal Education Evaluation
          • Legal Education at a Fixed-Facility Law School
          • Foreign Education
            • Guidelines for Applicants with a Foreign Law Degree
        • Pre-Legal Education
          • College Equivalency Education
    • Examinations
      • California Bar Examination
        • July 2026 California Bar Exam
        • 2025 February Bar Exam Notices
        • Exam Content Instructions by Question Type
        • Scope of the California Bar Examination
        • Laptops for the California Bar Examination
        • California Bar Exam Results
        • Bar Exam Emails
        • Safelisting Tips to Ensure You Receive Important Emails
        • California Bar Exam Grading
        • California Bar Exam Strategies and Stories Program
        • Scaling Explained
        • Virtual Oath Packet
        • Attorney’s Oath
        • Proctors & Graders
        • Bar Exam Passing Score Update
      • First-Year Law Students' Examination
        • June 2026 First-Year Law Students’ Exam
        • First-Year Law Students’ Exam Results
        • First-Year Law Students’ Exam Grading and Scope
      • Multistate Professional Responsibility Examination
      • Dates and Deadlines
        • July 2025 California Bar Examination
    • Applicant Resources
      • Testing Accommodations
        • Frequently Asked Questions: Testing Accommodations
        • Types of Accommodations and Approvals
        • Requesting Testing Accommodations
        • Appealing a Testing Accommodations Decision
        • Exam Environment and Allowable Items
      • Past Exams
      • Exam Statistics
        • California Bar Examination Studies
      • Refund of Fees Policy
      • Attorney Applicants
      • Lawyer Assistance Program
    • Moral Character
      • Moral Character Statement
      • Governing Law
      • Submitting an Application
        • Application Process
      • Factors and Conduct
      • Guidelines
    • Special Admissions
      • Multijurisdictional Practice (MJP) Program
        • Registered Servicemember Attorney or Registered Servicemember Spouse Attorney
        • Registered Legal Aid Attorney
        • Registered In-House Counsel
        • Frequently Asked Questions: Multijurisdictional Practice Program
      • Pro Hac Vice
      • Out-of-State Attorney Arbitration Counsel
      • Foreign Legal Consultants
        • Frequently Asked Questions: Foreign Legal Consultants
      • Practical Training of Law Students
      • Provisionally Licensed Lawyers
        • Provisional Licensure Program Background
        • Search Provisionally Licensed Lawyers
    • Law Schools
      • Law Schools Regulation
      • Law Schools Directory
    • Applicant Portal
    • February 2026 California Bar Exam
    • Law Schools Directory
    • Proctors & Graders
    • Admissions FAQs
  • Access to Justice
    • Initiatives
      • Awards
      • Access to Justice Publications
    • Volunteer for Pro Bono
      • Pro Bono Practice Program
        • Pro Bono Practice Program: FAQ
      • Pro Bono Opportunities Directory
      • Volunteer After a Disaster
      • Volunteer Opportunities to Assist Veterans & Service Members
    • Grants
      • Legal Services Trust Fund Program
      • Greg E. Knoll Justice Gap Fund
        • Donate Residual Funds (Cy Pres)
      • Legal Aid Funding
        • Equal Access Fund
    • Financial Institutions Banking Compliance
      • IOLTA-Eligible Financial Institutions
      • Leadership Financial Institutions
        • Frequently Asked Questions: Leadership Banks
    • Find a Certified Lawyer Referral Service
    • DEI Leadership Seal Program
    • Promoting Diversity, Equity, and Inclusion
  • About Us
    • Our Mission
      • Protecting the Public
        • Transparency & Accountability
      • Promoting Justice in California
      • Promoting Diversity, Equity, and Inclusion
        • DEI Leadership Seal Program
          • DEI Leadership Seal Committed Participants
          • State Bar DEI Leadership Seal Progress
          • DEI Leadership Seal Recipients
          • Frequently Asked Questions: DEI Leadership Seal Program
      • State Bar Stories
      • Government Affairs
        • Search for Legislation
        • Legislative Information
        • Legislative Chair Information
        • Codes, Regulations & Rules
        • California Government Information
        • 2017 Legislative Proposals
        • 2015 Legislative Proposals
        • 2013 Legislative Proposals
        • 2012 Legislative Proposals
        • 2011 Legislative Proposals
        • 2010 Legislative Proposals
        • 2009 Legislative Proposals
    • Who We Are
      • Board of Trustees
        • Board Executive Committee
        • Audit Committee
          • Audit Committee Roster
        • Finance Committee
          • Finance Committee Roster
        • Executive Committee
          • Board Executive Committee Roster
        • Contracts Committee Roster
        • Regulation and Discipline Committee
          • Regulation and Discipline Committee Roster
        • Roster
          • David Jargiello
          • Mattheus E. Stephens
          • Arnold Sowell Jr.
          • Ryan Harrison
          • Mary Huser
          • Cynthia Grande
          • Debra Gore
          • Sarah A. Good
          • Raymond A. Buenaventura
          • Patricia Barahona
          • Mark W. Toney, PhD
          • José Cisneros
        • Board Task Forces
          • More Task Forces and Working Groups
          • Client Security Fund Commission
      • Staff
        • Organizational Chart
      • Committees
        • Committee of Bar Examiners
          • Committee of Bar Examiners Roster
          • Minutes Archive
            • Committee of Bar Examiners Minutes 2013
            • Committee of Bar Examiners Minutes 2017
            • Committee of Bar Examiners Minutes 2014
            • Committee of Bar Examiners Minutes 2015
            • Committee of Bar Examiners Minutes 2016
            • Committee of Bar Examiners Jan. 24-25, 2014
            • Committee of Bar Examiners March 14, 2014
            • Committee of Bar Examiners April 24 2014 minutes
            • Committee of Bar Examiners June 27, 2014
            • Committee of Bar Examiners Aug. 22 2014 minutes
            • Committee of Bar Examiners Oct. 17 2014 minutes
            • Committee of Bar Examiners Dec. 12, 2014
            • Committee of Bar Examiners Dec. 6-7, 2013
            • Committee of Bar Examiners Oct. 18, 2013
            • Committee of Bar Examiners Aug. 23, 2013
            • Committee of Bar Examiners June 28-29, 2013
            • Committee of Bar Examiners May 3-4, 2013
            • Committee of Bar Examiners March 22, 2013
            • Committee of Bar Examiners Feb. 1-2 2013 minutes
        • Frequently Asked Questions: Judicial Nominees Evaluation
        • Alternative Dispute Resolution Certification Working Group
          • Alternative Dispute Resolution Certification Working Group Roster
          • Frequently Asked Questions: State Bar ADR Certification Program
          • Roster
        • Client Security Fund Commission
          • Client Security Fund Commission Roster
        • Committee of State Bar Accredited and Registered Schools
          • Committee of State Bar Accredited and Registered Schools Roster
          • Law School Council
            • Law School Council Roster
        • Commission on Judicial Nominees Evaluation
          • Commission on Judicial Nominees Evaluation Roster
          • Judicial Nominees Evaluation Reports
          • Background, Commission on Judicial Nominees Evaluation
          • Appointments Information
          • Review Committee of the Commission on Judicial Nominees Evaluation Roster
        • Committee on Professional Responsibility and Conduct
          • COPRAC Rules
          • Opinion Requests
          • Committee on Professional Responsibility and Conduct Roster
          • Educational Programs and Conferences
          • 29th Annual Statewide Ethics Symposium
        • Legal Services Trust Commission
          • Legal Services Trust Fund Commission Roster
        • Rules Revision
          • Commission for the Revision of the Rules of Professional Conduct
            • Proposed Rules of Professional Conduct
            • Commission for the Revision of the Rules of Professional Conduct Roster
            • Background
            • Archive of Board Action re Proposed Rules of Professional Conduct
          • Second Commission for the Revision of the Rules of Professional Conduct
            • Action Summaries - 2014 Rules Commission
        • Lawyer Assistance Program Oversight Committee
          • LAP Oversight Committee Roster
        • Council on Access and Fairness
          • Council on Access and Fairness Roster
        • Committee Appointment Opportunities
          • Standing Committee of the Delivery of Legal Services
          • Review Committee of the Commission on Judicial Nominees Evaluation
          • Judicial Council
            • State Bar Appointees to Judicial Council
        • California Board of Legal Specialization
          • California Board of Legal Specialization Roster
          • Privacy Law Group
            • Consulting Group on the Establishment of a Legal Specialization in Privacy Law Roster
          • Consulting Group on the Establishment of a Legal Specialization in Privacy Law
        • Archived Committees
          • Committee on Mandatory Fee Arbitration
          • Archived: California Access to Justice Commission
          • ABA House of Delegates
            • ABA House of Delegates Roster
          • Governance in the Public Interest Task Force
          • Archived: Task Force on Access Through Innovation of Legal Services
            • Task Force on Access Through Innovation of Legal Services Roster
          • Commission for the Revision of the Rules of Professional Conduct
          • Archived: Closing the Justice Gap Working Group
          • Archived: California Paraprofessional Program Working Group
          • California Attorney Practice Analysis Working Group
          • California Access to Justice Commission
            • California Access to Justice Commission Roster
          • American Bar Associate House of Delegates
          • Ad Hoc Commission on the Discipline System
          • Moral Character Working Group
            • Moral Character Working Group Roster
          • Malpractice Insurance Working Group
            • Malpractice Insurance Working Group Roster
          • Limited License Working Group
          • Committee on Special Discipline Case Audit
            • Committee on Special Discipline Case Audit Roster
          • Ad Hoc Commission on the Discipline System
          • American Bar Associate House of Delegates
          • Blue Ribbon Commission on the Future of the Bar Exam
            • Blue Ribbon Commission on the Future of the Bar Exam Roster
            • Blue Ribbon Commission Resources
          • California Access to Justice Commission
          • California Attorney Practice Analysis Working Group
            • California Attorney Practice Analysis Working Group Roster
          • California Paraprofessional Program Working Group
            • California Paraprofessional Program Working Group Roster
          • Closing the Justice Gap Working Group
            • Closing the Justice Gap Working Group Roster
          • Commission for the Revision of the Rules of Professional Conduct
          • Committee on Special Discipline Case Audit
          • Limited License Working Group
          • Malpractice Insurance Working Group
          • Moral Character Working Group
      • State Bar Holidays
      • Frequently Asked Questions
    • Careers
      • Make a Difference
      • Develop and Grow
      • Benefits
      • Diversity, Equity & Inclusion
      • View All Job Listings
        • Internship Program
      • Internship Program
      • Salary
    • Data & Reports
      • Discipline Statistics
      • View All
        • Judicial Nominee Evaluation Demographics Reports
        • California Justice Gap Study
          • 2019 California Justice Gap Study
          • Justice Gap Study Survey Data
          • 2024 Justice Gap Study Survey Data
    • Business Opportunities
      • Previous Opportunities
    • Public Meetings & Comment
    • Public Records Request
    • News
    • Transparency & Accountability
    • Five Years of Reform
  • Configure block
  • Remove block

Additional Searches

Find a Certified Lawyer Referral Service (link is external) Check Attorney Profile (link is external)

Menu

Attorney Profile

Michael Joseph Flemming #270657

License Status: Active

Address: Flemming Law, APC, 2888 Loker Ave E, Ste 110, Carlsbad, CA 92010-6683

Phone: 888-435-3664  |  Fax: Not Available

Email: jeqrncde@ktrkc.netkimeqkq@eyeun.orgmichael@criminaldefenselawyer.lawfmpys@cgsicwc.orgylljnw@mol.comqliujd@tlp.govdbwcujste@cleltcb.comjcbpbesn@oeuh.compcfegys@kkgg.orghsdmjybep@cyjtsnt.orgbryy@ebkm.govtsgyb@tedma.comcskm@dtwg.nethtoc@wuojf.netobrofaa@qyejsupq.orgibocafyc@cbaper.edullpughu@cgwojk.comrmskkcw@fdba.orgghbyqe@cbflq.netbywknpfm@pnbskj.net  |  Website: www.Flemming.Law

You are leaving the State Bar of California website and are being directed to an external web address provided to the State Bar by a California-licensed attorney. The State Bar relies on attorneys to maintain accurate and updated website listings and makes no warranties or other representations regarding the accuracy, content, or policies of external websites or for those of subsequent links.


You will be redirected after  seconds.




To access the site, click Go Now or disable your browser’s popup blocker.

  • More about This Attorney

    CLA Sections:
    None
    The California Lawyers Association (CLA) is an independent organization and is not part of the State Bar of California.

    Self-Reported Practice Areas:

    Note: The State Bar does not verify the accuracy of this content and makes no warranties regarding experience or competence in practice areas. The State Bar encourages those seeking legal help to search Certified Specialists, use Certified Lawyer Referral Services, search through LawHelpCA.org, and use the State Bar’s online public information to complement this information.
    • Criminal Law
    • Personal Injury

    Additional Languages Spoken:

    • By the attorney: Chinese
    • By staff: None reported

    Law School: Thomas Jefferson SOL; San Diego CA



License Status, Disciplinary and Administrative History

The table below shows an attorney’s license status changes, disciplinary actions, and administrative actions. Some administrative suspensions are subject to automatic removal from the attorney profile page pursuant to the State Bar's policy on removal of administrative actions. Administrative suspensions are non-disciplinary actions resulting from noncompliance with administrative requirements, such as the requirement to pay licensing fees or comply with Minimum Continuing Legal Education. Administrative suspensions that meet the criteria in the State Bar's policy on removal of administrative actions would not be displayed below.

Date License Status  Discipline  Administrative Action 
Present Active    
6/7/2010 Admitted to the State Bar of California

Additional Information:

  • About the disciplinary system


Start New Search »

Protecting the public & enhancing the administration of justice.

San Francisco (Main Office)
180 Howard St.
San Francisco, CA 94105
415-538-2000

Los Angeles
845 S. Figueroa St.
Los Angeles, CA 90017
213-765-1000

  • Facebook
  • X
  • Instagram
  • LinkedIn
  • YouTube

Footer 1

  • Help Center
  • Contact Us
  • Public Records (link is external)
  • News
  • Our Mission

Footer 2

  • Site Feedback (link is external)
  • Careers
  • Staff Logins
  • My State Bar Profile Login (link is external)

Footer suffix

  • Copyright ©2025 The State Bar of California
  • User Policies